PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010929692.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family LFY
Protein Properties Length: 432aa    MW: 47964.1 Da    PI: 7.9201
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010929692.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY596.75.2e-18214111386
         FLO_LFY   1 mdp.eafsaslfkwdpraaaaapp...arlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmk 91 
                     mdp +afsa++fkwdpr   +a+p    r +e  a ++a+ e++a+ + ++ rel e+f +yGvry+tva+++elGft+stLv+m++ e++++++
  XP_010929692.1   1 MDPgDAFSANVFKWDPRVPPTAAPpppCRSMEPPAPPAAAGEEEAVEQRQEPRELGEVFAGYGVRYATVARLGELGFTASTLVGMTEGEVEEVLA 95 
                     666367*********98766443311133333333333334555556666699****************************************** PP

         FLO_LFY  92 slseifrldllvGeryGikaavraerrrlee..................eeaekkrrkll.sedeet...aldalsqeglseepvqeekeaagsg 164
                     +l+++fr+dll+GeryGikaa+raerrr+ +                   +++++r+ ll s d+++   aldalsq glseepvq+e+eaa+sg
  XP_010929692.1  96 ALAHLFRWDLLLGERYGIKAALRAERRRILHhhqamlflhpdhhhqlpaGDDARRRMLLLnSPDHHHlagALDALSQGGLSEEPVQQEREAAASG 190
                     ****************************99889**************974445555555586666656679***********************9 PP

         FLO_LFY 165 geglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqC 259
                     ge +  a+  + ++++++++k+++ k k+++k+++e++ ee+ed   + +e +egs ++  erqrehPfivtepgevar+kknGLDYLf+LyeqC
  XP_010929692.1 191 GEAAVVANNDGRAKQRRSATKSSKGK-KKEKKRSSEEELEEEEDGWGSGSEGSEGSERSVVERQREHPFIVTEPGEVARAKKNGLDYLFHLYEQC 284
                     99977766666665444444444433.4444444444556666666777777777778888********************************** PP

         FLO_LFY 260 refLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwd 354
                     r+fLlqvq++akerG+kcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+kergenvGawrqacykplvai+ar+gwd
  XP_010929692.1 285 RHFLLQVQALAKERGDKCPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKERGENVGAWRQACYKPLVAISARHGWD 379
                     *********************************************************************************************** PP

         FLO_LFY 355 idavfnahprLsiWYvPtkLrqLChlerskas 386
                     idavfnahprLsiWYvPtkLrqLChl+rs+a+
  XP_010929692.1 380 IDAVFNAHPRLSIWYVPTKLRQLCHLARSNAT 411
                     *****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.8E-1881410IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MDPGDAFSAN VFKWDPRVPP TAAPPPPCRS MEPPAPPAAA GEEEAVEQRQ EPRELGEVFA  60
GYGVRYATVA RLGELGFTAS TLVGMTEGEV EEVLAALAHL FRWDLLLGER YGIKAALRAE  120
RRRILHHHQA MLFLHPDHHH QLPAGDDARR RMLLLNSPDH HHLAGALDAL SQGGLSEEPV  180
QQEREAAASG GEAAVVANND GRAKQRRSAT KSSKGKKKEK KRSSEEELEE EEDGWGSGSE  240
GSEGSERSVV ERQREHPFIV TEPGEVARAK KNGLDYLFHL YEQCRHFLLQ VQALAKERGD  300
KCPTKVTNQV FRYAKKVGAS YINKPKMRHY VHCYALHCLD EEASNALRRA YKERGENVGA  360
WRQACYKPLV AISARHGWDI DAVFNAHPRL SIWYVPTKLR QLCHLARSNA TTSNSVLGAT  420
SSNGLPPPPP LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1082504243178PROTEIN LEAFY
2vy2_A1e-1082504243178PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010929692.10.0floricaula/leafy homolog
SwissprotO040641e-155FLLH_POPTR; Floricaula/leafy homolog
SwissprotO485591e-154UNI_PEA; Protein UNIFOLIATA
TrEMBLA0A2H3YDG50.0A0A2H3YDG5_PHODC; floricaula/leafy homolog
STRINGXP_008797158.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-104floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]