PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010929563.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family TCP
Protein Properties Length: 313aa    MW: 33164.8 Da    PI: 9.8051
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010929563.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1241.6e-3887168283
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                     a+++++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLl qa+pai+++tg+++++as+ ++++s  +a+
  XP_010929563.1  87 APRRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLHQAEPAIIAATGSGTIPASALSSSTSTPAAG 168
                     7899*****************************************************************7662222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.9E-3292172IPR005333Transcription factor, TCP
PROSITE profilePS5136927.73793147IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MDPRGSSKVP PEAPKFHQAL GLPRGDKREH LTRLGSTSSS SSSSNLRHQE SSSSSRREDL  60
QIVMMTSAAP PTTTVTEKEE QQRRQLAPRR SSNKDRHTKV DGRGRRIRMP ALCAARIFQL  120
TRELGHKSDG ETIQWLLHQA EPAIIAATGS GTIPASALSS STSTPAAGST HQTNWTGFTA  180
GNTTTTTTGL GRPNHQGLWE PPAAGGFNSG FLQSAAAVPA MSNIGFHGLE LPGGAGGGMG  240
AMSFLSMLSG QGQQLPGLEL GLSQDGSMGG VINSQVLSHF YQQMEQGRGG EDGQLHHQQP  300
LLSPKENSQE STQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010929563.10.0transcription factor TCP20
RefseqXP_029122280.10.0transcription factor TCP20
RefseqXP_029122281.10.0transcription factor TCP20
SwissprotQ9LSD56e-57TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A2H3X0M11e-143A0A2H3X0M1_PHODC; transcription factor TCP20-like
STRINGXP_008776532.11e-144(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.12e-41TCP family protein
Publications ? help Back to Top
  1. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  2. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  3. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  4. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  5. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  6. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  7. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]