PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010929454.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 123aa    MW: 14168.7 Da    PI: 7.0755
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010929454.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.14e-133483756
                    HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
                     rr+++NRe+ArrsR RK+  + eL   v  L a N++L +el++  +e 
  XP_010929454.1 34 RRRRISNRESARRSRMRKQRHLGELWSQVVHLRATNRRLVDELNHVVEER 83
                    69*****************************************9988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-113092IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-113382No hitNo description
PfamPF001704.6E-103489IPR004827Basic-leucine zipper domain
CDDcd147027.28E-143484No hitNo description
PROSITE profilePS502179.7493486IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-103483No hitNo description
PROSITE patternPS0003603550IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MGSGDGVHLP CSGPGNTLTS DEADEHQPGL VDERRRRISN RESARRSRMR KQRHLGELWS  60
QVVHLRATNR RLVDELNHVV EERDRILYEN AWLRQEASDL REKLNYMQVE STASSAPTAS  120
YET
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14451RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010929454.12e-86PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0B2RDI02e-34A0A0B2RDI0_GLYSO; Ocs element-binding factor 1
TrEMBLK7K7Z22e-34K7K7Z2_SOYBN; Uncharacterized protein
STRINGGLYMA02G13960.26e-34(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-19basic leucine-zipper 42