PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010929452.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 372aa    MW: 39894.6 Da    PI: 7.0253
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010929452.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-3981140362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  XP_010929452.1  81 QAALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 140
                     7789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3078138IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3382138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52584138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361086122IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MLCDGEKLRI PSTNERPQNM GEMLLIPGNN NSENNNTDTN NNKNASTATS NSSTSTNSNM  60
IHAAAAPSAA RVMDKPAQDH QAALKCPRCD SSNTKFCYYN NYSLSQPRHF CKACKRYWTR  120
GGTLRNVPVG GGCRKNKRVK KPTSTAASDP LPSALMPPTN SVPPISLPNP ASHLDSPMNP  180
LFYSLPTASS SSGLAFSGLR APSVPHGISI PCTGFDLPQP QLNSLGLGFP SSQSQSQRDD  240
EFHLSQLQTS ASVMNDHPLF GSTAASLLLS SLRQPKKLED YQALMPYEEL HAASAEAIGN  300
LGVIKEVKLE GDSNAIDHNR IEWPIPLENS FDAIIPAAST SLAGDSSFLY WNSAIGAWPD  360
SAHCESSVAP LI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010929452.10.0dof zinc finger protein DOF1.4 isoform X2
TrEMBLA0A2H3X7M20.0A0A2H3X7M2_PHODC; dof zinc finger protein DOF1.4-like
STRINGXP_008779534.10.0(Phoenix dactylifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.12e-36Dof family protein