PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010928108.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 301aa    MW: 31857.3 Da    PI: 7.3902
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010928108.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-393595363
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                    +  +kcprCdstntkfCyynny+lsqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+sss
  XP_010928108.1 35 QPPIKCPRCDSTNTKFCYYNNYNLSQPRHFCKACRRYWTKGGVLRNVPVGGGCRKTKRSSS 95
                    6679*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.6E-333792IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5533892IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-263887IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MQDFQSIPGV AGRIFGGGED LRRLRGYPAA AAAQQPPIKC PRCDSTNTKF CYYNNYNLSQ  60
PRHFCKACRR YWTKGGVLRN VPVGGGCRKT KRSSSSSSSN SKTAKSSSAG GDRDSHRPSA  120
SLSSSDDCSL TAPNTEVSTS ASFPDSTLFA PSQTSLPNPP FHPPPQPVGP DTLGQQAPEI  180
FTEAVGASSF TGLMPAAATS PSVLRFNFSD PPPIQLGPQQ SPPKAAATVA EEVRMPGIMD  240
QTVPVDLPPF QGRSGGGDGH TGLEWPASVD PSLFDLTSAV DPGAYWNQSH WGDNDPSLYL  300
P
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010928108.10.0dof zinc finger protein 4
TrEMBLA0A2H3Z8B61e-156A0A2H3Z8B6_PHODC; dof zinc finger protein 4-like
STRINGXP_008809677.11e-157(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-32OBF binding protein 4