PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927984.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 170aa    MW: 19618.1 Da    PI: 8.5471
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927984.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.31.2e-1183134455
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +r rr+ +NRe+ArrsR RK++ + eL   v  L + N++L ++l++    
  XP_010927984.1  83 ERRKRRMLSNRESARRSRIRKQKHLNELSLQVFHLRTANRQLLDQLNHVMRD 134
                     6899***************************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.0E-979132No hitNo description
SMARTSM003381.5E-1280144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.80682145IPR004827Basic-leucine zipper domain
PfamPF001701.1E-982141IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.25E-1184133No hitNo description
CDDcd147023.84E-1585133No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MQPGEVASIR YVAPMHPPSF GPHFNMAQNS IPSFHFSSLF GPYAMQQVQT IPLIHEVGLP  60
SSCLSNNSTS DEGEEHQPSL AEERRKRRML SNRESARRSR IRKQKHLNEL SLQVFHLRTA  120
NRQLLDQLNH VMRDRDQILH ENAQLRDEES ELRKKLENLL MENTSSAPLT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
183104RRKRRMLSNRESARRSRIRKQK
296103RRSRIRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927984.11e-122PREDICTED: basic leucine zipper 43-like
TrEMBLM0TT042e-60M0TT04_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P23510_0015e-60(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-30basic leucine-zipper 42