PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927887.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 402aa    MW: 44214.3 Da    PI: 9.0062
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927887.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.61.5e-09204262563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r   NR +A rs +RK  +i+eLe+k+++L++e  +L  +l  l+     l++e+
  XP_010927887.1 204 KRAKRIWANRQSAARSKERKMRYIAELEQKAQSLQTETATLSAQLTLLRRDTNGLTAEN 262
                     9*********************************************9999888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-14200264IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852202265IPR004827Basic-leucine zipper domain
PfamPF077165.4E-8202253IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-10204258No hitNo description
SuperFamilySSF579594.85E-10204255No hitNo description
CDDcd147036.92E-22205254No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MDKARAPVHG GSVDFPPNSS RFSTASLSKF PVMGDPSPSS SSQANPESSH AGQLSHDISH  60
MLDFPRRNPG HRRALSEIPS LPDDTSFYSD LGVVGTHDGT DDTDEDFFSA YLDIEKLNSS  120
CAWSSVLSGG EPSGPAAAPP APSQTENLAS GSHERPRVRH QHSQSMDGSS LVLLGLSGEG  180
AAPAEMKKAI SAAKLADLAL VDPKRAKRIW ANRQSAARSK ERKMRYIAEL EQKAQSLQTE  240
TATLSAQLTL LRRDTNGLTA ENSELKLRLQ TMEQQVRLQD ALNDALREEV HRLKLATGQM  300
MPNGGPLMKF GSPLLGASQQ FYHHNQAMQS LLAGHQFQQL QIHPQHQQQL HPIQSLQQRH  360
MHPPQPQQQQ QQPPADPRMK RPMTSRNLRG EKTSDNSSNR KE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927887.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ040881e-112POF21_ARATH; Probable transcription factor PosF21
TrEMBLM0RSC91e-138M0RSC9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P14990_0011e-138(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-90bZIP family protein