PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927453.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 247aa    MW: 26967.2 Da    PI: 8.1105
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927453.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.44.7e-36459762
          zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +cprC+s+ntkf yynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++++
  XP_010927453.1  4 NCPRCNSSNTKFSYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRVK 59
                    7****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.941357IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-25357IPR003851Zinc finger, Dof-type
PfamPF027017.8E-31457IPR003851Zinc finger, Dof-type
PROSITE patternPS013610541IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGPNCPRCNS SNTKFSYYNN YSLSQPRYFC KGCRRYWTKG GSLRNVPVGG GCRKNRRVKS  60
VRIAGDPVST ARGLSYGAHR LTGQIRPDLV LDGMVGNLSS VLQSIIDVPA TTDASTIDVA  120
SLYANLLNQH PEVEPTLVVP ALAGETNESF RSTRGPGGAN SNQQIHVHLP DKNSFMECQR  180
ASEPIAEAVL RNGDQPPFGE LNFPVDPSGY ESLAFPSIFS SNYPAVFPSL TWEAANYQRF  240
GSLLEDM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927453.20.0uncharacterized protein LOC105049494
TrEMBLA0A2H3X8G81e-101A0A2H3X8G8_PHODC; dof zinc finger protein DOF3.5-like
STRINGXP_008779883.11e-102(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.15e-34Dof family protein