PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927395.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 270aa    MW: 28944.6 Da    PI: 9.7356
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927395.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.31.2e-16198248354
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     +l+r++r++kNRe+A rsR+RK+a++ eLe  v +Le+eN +L  + + l++
  XP_010927395.1 198 ALQRQKRMIKNRESAARSRERKQAYTVELESLVTQLEEENAQLL-KYQLLEN 248
                     79****************************************99.5666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.5E-10196259IPR004827Basic-leucine zipper domain
PfamPF001701.1E-15197242IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.323198240IPR004827Basic-leucine zipper domain
CDDcd147076.08E-21200246No hitNo description
SuperFamilySSF579592.81E-11200242No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-14201242No hitNo description
PROSITE patternPS000360203218IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MASSRVIASS SSANSEFLRQ SSLISPAIAD IQSSAGVYPI GTLGSVSMED LLRNIYPENA  60
GPFAREDGAT GGEARASASR QGNFPLPKEI ASRTVDEVWN EIAAGRKGDG GNGSSGEMTL  120
EDFLARAGTV REGEVRVPSG SGQGGFGLDS VSGGGFGQQQ LLPLENPVLG IGNGVEGGGG  180
GRRRVRKRPM LDPVDRAALQ RQKRMIKNRE SAARSRERKQ AYTVELESLV TQLEEENAQL  240
LKYQLLENVI PVTEKKKPKL SLRRTCSMLW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927395.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 isoform X2
TrEMBLM0SGW31e-84M0SGW3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P22470_0013e-84(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.19e-24G-box binding factor 4