PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010926809.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family TCP
Protein Properties Length: 301aa    MW: 31578.2 Da    PI: 8.5386
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010926809.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP126.33.3e-3957135280
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaessss 80 
                     a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+pai+++tgt++++as+  a++   
  XP_010926809.1  57 APKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPAIIAATGTGTIPASALAAAAAAA 135
                     789******************************************************************7773322222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.2E-3262133IPR005333Transcription factor, TCP
PROSITE profilePS5136928.48863117IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDPKGSSKLP QEVPRFHQAL GLPQSDKREP TTTTPEARDA PERELAAEKE EQRRQLAPKR  60
SSNKDRHTKV DGRGRRIRMP ALCAARIFQL TRELGHKSDG ETIQWLLQQA EPAIIAATGT  120
GTIPASALAA AAAAAPMSHP AASAPAGLHQ KLDDLGQAAG PRPNWAMLGA NLARSHPGLW  180
PPPISGFNSG FAPSTSNLGS GGDSSYMQRM GLHGLELPGG NLGAMSFASL LGGHGQQLPG  240
LELGLSQDGH IGVLSPQALS QFYQQMGQGR GVSGAGSGQL QQNQQHQQTP SAEDDSQGSG  300
Q
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00005PBMTransfer from 484486Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019707167.10.0transcription factor TCP20 isoform X1
RefseqXP_029121535.10.0transcription factor TCP20 isoform X2
SwissprotQ9LSD53e-70TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A2H3XZ491e-168A0A2H3XZ49_PHODC; transcription factor TCP20-like
STRINGXP_008790742.11e-168(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.14e-54TCP family protein
Publications ? help Back to Top
  1. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  2. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  3. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  4. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  5. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  6. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  7. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]