PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010926520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 304aa    MW: 33746.7 Da    PI: 5.4357
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010926520.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.96.8e-16234278549
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                     +r++r++kNRe+A rsR+RK+a+i +Lee+v +L++ Nk+Lkk+ 
  XP_010926520.1 234 RRQKRMIKNRESAARSRARKQAYINQLEEEVRQLTNTNKRLKKQK 278
                     79****************************************654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.6E-11229291IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.783232280IPR004827Basic-leucine zipper domain
CDDcd147078.45E-23234280No hitNo description
SuperFamilySSF579597.5E-11234279No hitNo description
Gene3DG3DSA:1.20.5.1703.6E-14234279No hitNo description
PfamPF001701.9E-13234279IPR004827Basic-leucine zipper domain
PROSITE patternPS000360237252IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MVSPNRGQGP QYPPPFLRQG SVYNLTLDEV QSHLPELGKP LNAMNFDELL NSVLAVEQQI  60
HAPSSSSPSA SISQLLPGNY NLNCALSCKT VDEVWREIIR QEEQGNTESP ATLGETTLED  120
FLVRAGAISM GSLGCGGVDG DSQALLSVNP VQQEEWLQYQ LAAAQQQQQQ QHMDLLGSSL  180
SVFGNSISNA GFNENQQMGL PMVSVSMAKS ISADSPSATE THRPDEIIDR SIERRQKRMI  240
KNRESAARSR ARKQAYINQL EEEVRQLTNT NKRLKKQKEE EILSHLNTPS EPRYQLRRTS  300
SAPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010926520.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM0S5Z36e-84M0S5Z3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P07520_0012e-83(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2547835
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-42ABA-responsive element binding protein 3