PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010926296.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family CAMTA
Protein Properties Length: 915aa    MW: 103582 Da    PI: 6.2731
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010926296.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1182.64.4e-57201362118
            CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                     l+ ++rwl+++ei++iL+n++k++++ e++++p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+v+vl+cyYah+een++fqr
  XP_010926296.1  20 LEAQRRWLRPTEICEILQNYRKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQR 114
                     56799****************************************************************************************** PP

            CG-1  97 rcywlLeeelekivlvhylevk 118
                     r+yw+Lee++ +ivlvhylevk
  XP_010926296.1 115 RSYWMLEEDYMHIVLVHYLEVK 136
                     *******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143785.16315141IPR005559CG-1 DNA-binding domain
SMARTSM010769.2E-7918136IPR005559CG-1 DNA-binding domain
PfamPF038591.8E-5021135IPR005559CG-1 DNA-binding domain
SuperFamilySSF812961.68E-11344415IPR014756Immunoglobulin E-set
PROSITE profilePS5029719.253497626IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.209.5E-20507627IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484036.37E-19521627IPR020683Ankyrin repeat-containing domain
CDDcd002045.83E-16521624No hitNo description
PROSITE profilePS500888.576532564IPR002110Ankyrin repeat
PfamPF127969.0E-8537627IPR020683Ankyrin repeat-containing domain
SMARTSM002480.0042565594IPR002110Ankyrin repeat
PROSITE profilePS500888.897565597IPR002110Ankyrin repeat
SMARTSM00248560604633IPR002110Ankyrin repeat
SuperFamilySSF525408.76E-8737791IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.064740762IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.59741770IPR000048IQ motif, EF-hand binding site
PfamPF006120.0017742761IPR000048IQ motif, EF-hand binding site
SMARTSM000150.02763785IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.865764792IPR000048IQ motif, EF-hand binding site
PfamPF006123.3E-4766785IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 915 aa     Download sequence    Send to blast
MADARRYGLT PQLDIEQILL EAQRRWLRPT EICEILQNYR KFRIAPEPPN KPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKAGSVDVLH CYYAHGEENE NFQRRSYWML  120
EEDYMHIVLV HYLEVKGNKP SFGRTRDVQE TAQVVNMDSP VCSNSFTNHS QLPSQTTDAE  180
SPNSAHTSEY EDAESADNYQ ASSRYNSFLE MQQYGDGPVM DVRLRNPHFP IASINNQCDI  240
QGTQAAEPKS DFNSVAQEDF MRVFDGTGLG LTFSGPRTQY DLTSWDEVLE HCTTGFQTPP  300
FHPGQAAAVE DNPRLETSTG ELYTDELGVK QVDVTTTLDK SLWQILITGT FLKNKEDVEK  360
CQWSCMFGEI EVPAELLADG TLRCHAPLHK SGRVPFYITC SNRLACSEVR EFEFRVDDAQ  420
DMETLDSHGY DTNEMHLHVR LEKLLNLGPV DQQKVVANSV KEHLHLSNKI SSLMMEFDDE  480
WSNLLKLTHE EGFSPDNAKD QLLEKLMKEK LHSWLLHKVA EDGKGPNVLD NEGQGVLHLA  540
AALGYDWAIK PTITSGVNIN FRDVHGWTAL HWAAYCGRER TVVALIALGA APGVLTDPTP  600
EFPTGRTPAD LASANGHKGI AGFLAESSLT NHLSTLTLKE SEGSDIAELS GITDVEDVVE  660
KSAIQVADGD LQAGLSLKDS LTAVRNASLA AARIYQVFRV HSFHRKKLIE YGDDKCGTSD  720
ERALSLIYLK TAKPGQHDMP QHAAAIRIQN KFRGWKGRKE FLIIRQRIVK IQAHVRGHQV  780
RKHHKKIIWT VSIVEKAILR WRRKGSGLRG FRSEGLLEGR STQNQAVKED DYDFLQEGRK  840
QTEARLQKAL ARVKSMVQYP EARDQYRRLV NVVTELQESK AMQDRILNES SEAADGDFMI  900
ELEELWQDDT PMPTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4hb5_A2e-1152162425122Engineered Protein
4hb5_B2e-1152162425122Engineered Protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010926296.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X3
SwissprotQ9FY740.0CMTA1_ARATH; Calmodulin-binding transcription activator 1
TrEMBLB9F5L80.0B9F5L8_ORYSJ; Uncharacterized protein
STRINGGSMUA_Achr6P10390_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09410.10.0ethylene induced calmodulin binding protein