PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010926293.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family CAMTA
Protein Properties Length: 1044aa    MW: 117897 Da    PI: 5.7105
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010926293.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1182.35.3e-57201362118
            CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                     l+ ++rwl+++ei++iL+n++k++++ e++++p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+v+vl+cyYah+een++fqr
  XP_010926293.1  20 LEAQRRWLRPTEICEILQNYRKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQR 114
                     56799****************************************************************************************** PP

            CG-1  97 rcywlLeeelekivlvhylevk 118
                     r+yw+Lee++ +ivlvhylevk
  XP_010926293.1 115 RSYWMLEEDYMHIVLVHYLEVK 136
                     *******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143785.16315141IPR005559CG-1 DNA-binding domain
SMARTSM010769.2E-7918136IPR005559CG-1 DNA-binding domain
PfamPF038592.2E-5021135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.107.4E-5457543IPR013783Immunoglobulin-like fold
SuperFamilySSF812962.8E-16458544IPR014756Immunoglobulin E-set
PfamPF018334.8E-7458536IPR002909IPT domain
PROSITE profilePS5029719.253626755IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.1E-19637756IPR020683Ankyrin repeat-containing domain
CDDcd002046.11E-16650753No hitNo description
SuperFamilySSF484037.62E-19650756IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500888.576661693IPR002110Ankyrin repeat
PfamPF127961.1E-7666756IPR020683Ankyrin repeat-containing domain
SMARTSM002480.0042694723IPR002110Ankyrin repeat
PROSITE profilePS500888.897694726IPR002110Ankyrin repeat
SMARTSM00248560733762IPR002110Ankyrin repeat
SuperFamilySSF525401.12E-7866920IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.064869891IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.59870899IPR000048IQ motif, EF-hand binding site
PfamPF006120.002871890IPR000048IQ motif, EF-hand binding site
SMARTSM000150.02892914IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.865893921IPR000048IQ motif, EF-hand binding site
PfamPF006123.9E-4895914IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1044 aa     Download sequence    Send to blast
MADARRYGLT PQLDIEQILL EAQRRWLRPT EICEILQNYR KFRIAPEPPN KPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKAGSVDVLH CYYAHGEENE NFQRRSYWML  120
EEDYMHIVLV HYLEVKGNKP SFGRTRDVQE TAQVVNMDSP VCSNSFTNHS QLPSQTTDAE  180
SPNSAHTSEY EDAESADNYQ ASSRYNSFLE MQQYGDGPVM DVRLRNPHFP IASINNQCDI  240
QGTQAAEPKS DFNSVAQEDF MRVFDGTGLG LTFSGPRTQY DLTSWDEVLE HCTTGFQTPP  300
FHPGQAAAVE DNPRLETSTG ELYTDELGVK QVDVTTTLDK SLWQLTTADI GLLGTSNAVL  360
ENGMSIEENV NAPFLIKQAS LDFSNMEREG LKKYDSFSRW VSKELGEVDD SHPISNSGVY  420
WDTVQSESVI EDSGMSNHAR LDAYIMSPSL SQDQLFSIID FTPNWAYTGM ETKILITGTF  480
LKNKEDVEKC QWSCMFGEIE VPAELLADGT LRCHAPLHKS GRVPFYITCS NRLACSEVRE  540
FEFRVDDAQD METLDSHGYD TNEMHLHVRL EKLLNLGPVD QQKVVANSVK EHLHLSNKIS  600
SLMMEFDDEW SNLLKLTHEE GFSPDNAKDQ LLEKLMKEKL HSWLLHKVAE DGKGPNVLDN  660
EGQGVLHLAA ALGYDWAIKP TITSGVNINF RDVHGWTALH WAAYCGRERT VVALIALGAA  720
PGVLTDPTPE FPTGRTPADL ASANGHKGIA GFLAESSLTN HLSTLTLKES EGSDIAELSG  780
ITDVEDVVEK SAIQVADGDL QAGLSLKDSL TAVRNASLAA ARIYQVFRVH SFHRKKLIEY  840
GDDKCGTSDE RALSLIYLKT AKPGQHDMPQ HAAAIRIQNK FRGWKGRKEF LIIRQRIVKI  900
QAHVRGHQVR KHHKKIIWTV SIVEKAILRW RRKGSGLRGF RSEGLLEGRS TQNQAVKEDD  960
YDFLQEGRKQ TEARLQKALA RVKSMVQYPE ARDQYRRLVN VVTELQESKA MQDRILNESS  1020
EAADGDFMIE LEELWQDDTP MPTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4hb5_A2e-1165075325122Engineered Protein
4hb5_B2e-1165075325122Engineered Protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010926291.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X1
RefseqXP_010926292.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X1
RefseqXP_010926293.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X1
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLM0T5T80.0M0T5T8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P10390_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1