PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010926212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GeBP
Protein Properties Length: 297aa    MW: 32053.2 Da    PI: 9.0988
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010926212.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57383.62.7e-26107201297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +f+r+wse+Dei +LqGl+ +  ++g+    d++ fy+ +++s+   +++sql+eK+rrL+kKf+ ++ ++++g++ps  ++hd++ ++l+ ++W
  XP_010926212.1 107 KFHRIWSESDEIRFLQGLLGC-WSQGMVFPRDLNLFYDRFSESMPQPYTRSQLSEKLRRLRKKFRIMSGRIARGQDPSRLAPHDRDLLHLCTRLW 200
                     699******************.677988889**************************************************************** PP

          DUF573  97 g 97 
                     +
  XP_010926212.1 201 H 201
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.3E-25108201IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MATPTPTPTP TLRIKSAARK LPIKRKPSSD PNPTSTPTQD SLLLAPKPEA DVPLSALPPD  60
NGYDDEDDED AEDDDESEYV LASSAAGVEG GPGGASAAGD LRSPPFKFHR IWSESDEIRF  120
LQGLLGCWSQ GMVFPRDLNL FYDRFSESMP QPYTRSQLSE KLRRLRKKFR IMSGRIARGQ  180
DPSRLAPHDR DLLHLCTRLW HPSYASSSPF SIPDAAAPGS GGNKRRRPNP RAPSGHARAE  240
GPPTPQLPLP PPPPPPPPPS LPSQPAPPTP SPALLVQPAL PLPRAPSRPS HASPPAL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029121387.10.0undifferentiated embryonic cell transcription factor 1-like
TrEMBLM0S9Z94e-77M0S9Z9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P21580_0011e-76(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.27e-14DNA-binding storekeeper protein-related transcriptional regulator