PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010925239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 162aa    MW: 17898.8 Da    PI: 10.8322
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010925239.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.44.2e-1581142162
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     +ke kr +r+ +NR++A+  R+RKka++  Le kvk Le++N+++ ++l++l++e   l++ 
  XP_010925239.1  81 DKEHKRLKRLLRNRVSAQQARERKKAYLNDLEAKVKDLEKKNSEMEERLSTLQNENRMLRQI 142
                     5899***************************************************9988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000413.1E-5621IPR001630cAMP response element binding (CREB) protein
PRINTSPR000413.1E-58096IPR001630cAMP response element binding (CREB) protein
SMARTSM003382.3E-1581145IPR004827Basic-leucine zipper domain
PfamPF001703.3E-1382143IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.47283146IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.25E-1385143No hitNo description
Gene3DG3DSA:1.20.5.1702.9E-1685145No hitNo description
CDDcd147041.79E-1586136No hitNo description
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
PRINTSPR000413.1E-598118IPR001630cAMP response element binding (CREB) protein
PRINTSPR000413.1E-5118135IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MQDQATSSLP SSSERSSSSA PQMEVKEGLE SDEEIRRVPE FGVEQAGPST SGRETGSGAG  60
SDRAKSSAPA GRRKRGRSPV DKEHKRLKRL LRNRVSAQQA RERKKAYLND LEAKVKDLEK  120
KNSEMEERLS TLQNENRMLR QILKNTTVSR RGSGSSANGE GQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A8e-15106145342Transcription factor HY5
2oqq_B8e-15106145342Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010925239.11e-111PREDICTED: transcription factor HY5-like
SwissprotO246465e-64HY5_ARATH; Transcription factor HY5
TrEMBLM0U4B49e-77M0U4B4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P28570_0012e-76(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.12e-64bZIP family protein