PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010924920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 224aa    MW: 23289.6 Da    PI: 8.1134
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010924920.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.22.4e-402282262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +e++lkcprCdstntkfCyynny+lsqPr+fCk CrryWtkGGalrn+PvGgg+rkn k+s
  XP_010924920.1 22 PEQHLKCPRCDSTNTKFCYYNNYNLSQPRHFCKDCRRYWTKGGALRNIPVGGGTRKNSKRS 82
                    7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-261677IPR003851Zinc finger, Dof-type
PfamPF027011.4E-332480IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3942680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MQGTTAVAGA VQGGAKPPLP EPEQHLKCPR CDSTNTKFCY YNNYNLSQPR HFCKDCRRYW  60
TKGGALRNIP VGGGTRKNSK RSAASATGGA TASKRPSTST PPPPPSDHLP KPEPFSVLYP  120
PATDPDDRLL DITGSFSSLL ASSGGFGNLP ECFGSGAAGG ATVGMRNSGG PNSSIEGGMD  180
QLQSSSDSNG NENSAALENF LGDSGGWANG WSDLRIYTPG SGFQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924920.11e-163dof zinc finger protein DOF3.1
SwissprotO821552e-40DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A2H3Z0741e-121A0A2H3Z074_PHODC; dof zinc finger protein DOF3.1-like
STRINGXP_008806550.11e-122(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-36DOF zinc finger protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]