PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010924100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 147aa    MW: 16417.5 Da    PI: 9.7682
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010924100.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.94.4e-132484363
                    XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                    ++kr++r+ +NRe+ArrsR RK++ ++ L+  v +L +eN++     +  +k++ ++++e+
  XP_010924100.1 24 DRKRQKRMLSNRESARRSRIRKQKHLDDLKAQVSQLRQENSEIVAAWSLATKQYLAVEAEN 84
                    57**************************************998888888777777766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-142286IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4042466IPR004827Basic-leucine zipper domain
PfamPF001703.2E-102568IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.5E-122677No hitNo description
Gene3DG3DSA:1.20.5.1707.7E-1026101No hitNo description
CDDcd147026.12E-192777No hitNo description
PROSITE patternPS0003602944IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MASSNGTSSG SSALFPGSGE AVMDRKRQKR MLSNRESARR SRIRKQKHLD DLKAQVSQLR  60
QENSEIVAAW SLATKQYLAV EAENSVLRTR MMELSSRLQS LDDILHLLNG GFSTSHGHQF  120
TDGFCNPWNS MCMNPPIMAS ADLPQYN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12446RKRQKRMLSNRESARRSRIRKQK
23845RRSRIRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924100.11e-107bZIP transcription factor 11
TrEMBLM0SIN72e-54M0SIN7_MUSAM; Uncharacterized protein
TrEMBLM0SIP62e-54M0SIP6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P28710_0016e-54(Musa acuminata)
STRINGGSMUA_Achr3P28800_0016e-54(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44593367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.12e-39G-box binding factor 6