PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010923731.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 572aa    MW: 62165.9 Da    PI: 7.0782
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010923731.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31e-10417475563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr +r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+  +a l++++
  XP_010923731.1 417 KRVKRILANRQSAARSKERKMRYISELEQKVQTLQTEATTLSAQLTLLQRDSAGLTNQN 475
                     899***********************************************999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-18413477IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.99415478IPR004827Basic-leucine zipper domain
PfamPF001702.1E-9417475IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.45E-11417468No hitNo description
Gene3DG3DSA:1.20.5.1704.3E-10417474No hitNo description
CDDcd147031.16E-23418469No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MEETEEPRND LMQRLKSSGN TCSSTLTKLP NRLDLSSFNP SNSCSQARGP YRQLPPSPSF  60
SPESSKRPGI PPAHPNFPPA SPFPQIPPSA AARSPSAPGF HAAPSHSRSL SQPAFFNLDS  120
LASLSPPPSS ADVSMEDRVT ASSPAPIPPA APLARTSSGR VSGDGLPPRK AHRRSQSDIP  180
FGFFQSGLPM AGIPPPAPQR TQGFLERSAS AREGFGAGRQ MPQFVKQENE WDQRDGDSSA  240
EGIGERKSEG DAGDDLINAY MNLESLDTLN SSGTEEKRED LDSRASGTKT NGADSSENEA  300
ESSINESGGG IQFRTPLMER KEGTKRSAPL DPASVNSRHC RSISMDSFMG KLHFGDESPK  360
LPPSPGNQSG QHSRSGSMDG TTSTFSLEFG NGEFSAAEMK KIMANEKLAE MALTDPKRVK  420
RILANRQSAA RSKERKMRYI SELEQKVQTL QTEATTLSAQ LTLLQRDSAG LTNQNSELKY  480
RLQAMEQQAH LRDALNEALT AEIQRLKLAT GEISEAHLSK GMNQQVSLNP QMFQLQQLQS  540
QQQQHQQSTQ IPLYQLQPQQ QTDATAKLES NK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010923730.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_010923731.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_010923732.10.0PREDICTED: probable transcription factor PosF21
TrEMBLF6I1810.0F6I181_VITVI; Putative uncharacterized protein
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-100bZIP family protein