PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010923540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family CPP
Protein Properties Length: 793aa    MW: 86501.4 Da    PI: 5.5446
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010923540.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.61.8e-16488526240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+CnCkkskClk+YCeCfaag++Cse C+C++C+Nk 
  XP_010923540.1 488 ACKRCNCKKSKCLKLYCECFAAGVYCSEPCSCQGCFNKP 526
                     589**********************************96 PP

2TCR50.54e-16573611139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  XP_010923540.1 573 RHKRGCNCKKSSCLKKYCECYQGGVGCSISCRCEGCKNA 611
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.8E-19487528IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.792488613IPR005172CRC domain
PfamPF036384.9E-12490525IPR005172CRC domain
SMARTSM011144.4E-17573614IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-11575611IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MDTPERSKIG GTPLSKFEDS PVFNFINSLS PIQPVKSVDS IHTEQSYLQP VSSIFTSPHA  60
NLQRESRFLI RNSLSEFSKD ESSSDNVNES NLCTGVQNAV SLSRCTVIAQ ENCSVICSLN  120
EATVDPPDEC SILPSNLPQS EQHDSGSPDH NTAPWYDIKM DVTLDIDRAP VELVHFVQNG  180
LDKRKSLLAS ESEFLENYPL EQNKDEAVGC DWVNLISDNA DVPLIFDSNN ESEVCRGPIE  240
ELGDSSKPAQ DLDNSQKTQP DESFGPCVQN AAQDPPVNHS AENGKEDETA HTLQILSGTC  300
QNQVLLSNGT SDQIQSGHKV ESQQQRGIRR RCLVFDMAGI SKKNLQSNSN QHSSSSLLSN  360
EKMASDDKCS TPGTSQAPCV LPGIGLHLNT LATTSKERPV TQEMLASGKE LISMPCPVGP  420
FGPTTSGWKG KSLAVEKDVS PTENEVQNLQ IMHNDASQAP ALGNGEELNQ VSPKKKRRKS  480
EHGGESEACK RCNCKKSKCL KLYCECFAAG VYCSEPCSCQ GCFNKPIHEE TVLATRKQIE  540
SRNPLAFAPK VIRTSETGQE MGEDANKTPA SARHKRGCNC KKSSCLKKYC ECYQGGVGCS  600
ISCRCEGCKN AFGRKEGIVL IGAEEIEQGE HETDHCEREK DKPDDDGQQH ATVQIDENNS  660
SEGLLSVTPL QTCRPSVKLS FCSSAKPPRS STLPVGFSPW LYTSQHFQKS EILPQHKLEK  720
HVNTALEDDT PDVLRCDAPP SNGVKTTSPN RKRVSPPHNG IGLLPSRKGG RKVILKSIPS  780
FPSLTGDASE DYP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1749261014120Protein lin-54 homolog
5fd3_B4e-1749261014120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1473477KKKRR
2473478KKKRRK
3474478KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010923540.10.0protein tesmin/TSO1-like CXC 3
TrEMBLA0A2H3XX470.0A0A2H3XX47_PHODC; protein tesmin/TSO1-like CXC 2
STRINGXP_008789994.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-125Tesmin/TSO1-like CXC domain-containing protein