PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010922938.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 333aa    MW: 36202.6 Da    PI: 7.9842
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010922938.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.81.8e-16263310553
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                     +r++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++Lkk+ +el 
  XP_010922938.1 263 RRQKRMIKNRESAARSRARKQAYTNELEHKVSRLEEENDRLKKQ-KELD 310
                     79***************************************954.4444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.4E-15256309No hitNo description
SMARTSM003383.8E-13259331IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.553261306IPR004827Basic-leucine zipper domain
CDDcd147072.53E-25263312No hitNo description
SuperFamilySSF579592.19E-11263308No hitNo description
PfamPF001702.7E-13263307IPR004827Basic-leucine zipper domain
PROSITE patternPS000360266281IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGIQTMASQG GGGTGGQQSQ IQSLGRQGSL YGLTLNEVQS HLGEPLNSMN LDELLKSVLP  60
EGNQSLGMDL DSATSQFTSG SGLQRQGSIT MPRTLSKKTV DEVWRDIQQG QQKSNEEHRS  120
GHGRQLTFGE MTLEDFLLKA GVVVEGSAKD ANDIMGNVGP GGSSDLMAGV QDFGQGAHWL  180
QRYHQMAAMD HQQPGQQSLI GAYAPSHPVP QPLGVGTSPI LDAVFPDGQM SIASPGMGAF  240
SDPQTPGRKR AASGEMVDKL MERRQKRMIK NRESAARSRA RKQAYTNELE HKVSRLEEEN  300
DRLKKQKELD KLLSSVPLPE PRYQLRRTSS API
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922938.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_010922939.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES37e-93AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM0U8H81e-127M0U8H8_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP12190_0011e-127(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-89ABA-responsive element binding protein 3