PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010922885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 512aa    MW: 55081.1 Da    PI: 6.3435
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010922885.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.1e-38121181262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s +tkfCyynny+++qPr+fC++C+ryWt+GG++rnvPvG+grrk+k+s 
  XP_010922885.1 121 PDKILPCPRCNSLDTKFCYYNNYNVNQPRHFCRNCQRYWTAGGTMRNVPVGSGRRKSKHSA 181
                     7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30118178IPR003851Zinc finger, Dof-type
PfamPF027016.9E-32123179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.723125179IPR003851Zinc finger, Dof-type
PROSITE patternPS013610127163IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MADSRDPAIK LFGRTIPLTE GQGQAADGEN SGPASATEEP PAVDEKEESR VVTDAEVKDS  60
VSDAAEELDR TKLSSCSGLD SGKEDDHQMS AHEDKAVADP KPEKDQTEAN ASNQEKVLKK  120
PDKILPCPRC NSLDTKFCYY NNYNVNQPRH FCRNCQRYWT AGGTMRNVPV GSGRRKSKHS  180
ASHYRHIMMT SDGMPCNQVD ASDSSSHQAL PAGLSSPTRP LKGNGTVLKF GSEASLCESM  240
ASVLGDREQK RNAEVGSSAG GENREEPSCA SFVMASNCVE NDHSKIAFHK EQNGLQSGCN  300
GLTPMHHLQC FPGPPWIYPW HPGWNNVSSM AAGRCSSELV YRPENGSPNP VPWCPPMMAT  360
PAFCAPTIPF PFVPASFWGC MPSWANGTLS MPWVGSNGGL SPSSSASSSS GSGNGSPTLG  420
KHSRDATSQS EEKTEKSLWV PKTLRIDDPD EAAKSSIWAT LGIKPDESIK KGGIFKAFHS  480
KTESKDHTAD AAQVLQANPA ALSRSQTFQE CT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922885.10.0cyclic dof factor 1
TrEMBLA0A2H3Y2P10.0A0A2H3Y2P1_PHODC; cyclic dof factor 2-like
STRINGXP_008792513.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-75cycling DOF factor 2