PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010922822.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 159aa    MW: 17516.8 Da    PI: 9.4991
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010922822.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.61.1e-122884460
                    XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60
                     k+++r+ +NRe+ArrsR RK++ ++ L++ v +L ++  +    l++ +k++  ++
  XP_010922822.1 28 QKKQKRMLSNRESARRSRMRKQKHLDDLRTQVSQLRQQGGRILAALNHTTKQYVGVE 84
                    69************************************9999999999999886555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.9E-172589IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.0252790IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.0E-1028104No hitNo description
SuperFamilySSF579591.29E-112981No hitNo description
PfamPF001701.9E-92980IPR004827Basic-leucine zipper domain
CDDcd147027.62E-183080No hitNo description
PROSITE patternPS0003603247IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MSMTSSSGTS SGSSGLLLPG SEAAAFDQKK QKRMLSNRES ARRSRMRKQK HLDDLRTQVS  60
QLRQQGGRIL AALNHTTKQY VGVETENSVL RTQMMELTSR LNSLHEILHF LNGGDLSSSH  120
GLLSACEGPQ IADGFGNPCN SVYMSQPIMA SADMLQYYY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14148RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922822.11e-115PREDICTED: ocs element-binding factor 1-like
TrEMBLB9H4F32e-48B9H4F3_POPTR; BZIP transcription factor family protein
STRINGPOPTR_0005s25290.16e-48(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44593367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-35basic leucine-zipper 44