PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010922356.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 296aa    MW: 30701.3 Da    PI: 9.6105
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010922356.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.3e-392383262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +e alkcprCdstntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  XP_010922356.1 23 PEPALKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 83
                    67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-34776IPR003851Zinc finger, Dof-type
PfamPF027018.3E-332681IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.7392781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAAGLARPVS MTDRARLAKI PQPEPALKCP RCDSTNTKFC YFNNYSLSQP RHFCKTCRRY  60
WTRGGALRNV PVGGGCRRNK RTKSSGSSSK SSTTADRHAA TSSSTSSTGT SGGGAILPNI  120
APPAGQLPPF MASLHPLADY GGSSNLGLSF TGMQPMEQLD YQVGSSSSIG LEQWRLQQIQ  180
QFPFLGGLEA PPAPPSQPVP VLYPLDGESG GEGFAGQLLP KVSAGSGLIT QLASVKMEDN  240
PQGLNLPRQY LGFPGNNHYW GGSTGGAGAG AGSGGSAGWT GDLSGFNSSS TSGNIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922356.20.0dof zinc finger protein DOF5.1
TrEMBLA0A2H3YRJ61e-139A0A2H3YRJ6_PHODC; dof zinc finger protein DOF5.1-like isoform X1
TrEMBLA0A2H3ZVV01e-139A0A2H3ZVV0_PHODC; dof zinc finger protein DOF5.1-like isoform X2
STRINGXP_008802760.11e-140(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.22e-47OBF-binding protein 3