PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010922246.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 230aa    MW: 25448.5 Da    PI: 6.0961
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010922246.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.14.5e-0976126151
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                     e+e k+ r+   NReA r++R++Kka+ + Lee+vk+L   N++L k+l+ 
  XP_010922246.1  76 EEEQKKSRKPLGNREAVRKYREKKKAQAAYLEEEVKKLRLLNQQLLKRLQG 126
                     7899******************************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.8E-1275144No hitNo description
SMARTSM003383.0E-976143IPR004827Basic-leucine zipper domain
PfamPF077165.3E-1277133IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.97978144IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.56E-680126No hitNo description
CDDcd146861.80E-981134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MDAVRMDDGE VDLSSHLLLP NSEMTSSFEE YFRNSRKCTH THTCNPPGPA DAMHTHTCYH  60
THTQVFATAD GEREGEEEQK KSRKPLGNRE AVRKYREKKK AQAAYLEEEV KKLRLLNQQL  120
LKRLQGQAAL EAEVVRLRSH LMDLRAKIDS ELGTFPFQKQ CSGADLRCNN RAQCFGGSGE  180
VAGWEGSCGP VVVDCQINPN GDIGLNLEIA EAVNSMDVVG SLVSSASQAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922246.11e-174PREDICTED: uncharacterized protein LOC105045595
SwissprotQ8GTS26e-58BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0P0V9D34e-84A0A0P0V9D3_ORYSJ; Os01g0801901 protein
STRINGGSMUA_Achr4P10150_0012e-82(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.17e-50bZIP family protein