PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010921318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 530aa    MW: 57170.6 Da    PI: 5.2542
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010921318.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.77e-40142202262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  XP_010921318.1 142 PDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHSA 202
                     78999*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30128199IPR003851Zinc finger, Dof-type
PfamPF027012.7E-32143200IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975146200IPR003851Zinc finger, Dof-type
PROSITE patternPS013610148184IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MVAGIWKRRL DGAEMSEPRD PAIKLFGKTI PLPESLPPPP PAEAEDKEAR PTDPAPPPDP  60
AEDGEKDTCK ENTEMEVNNP NPDVPEEVNQ CDPHNSGLHN GNGDDNEGPN QDEKVATDSK  120
AEHEHDKTEA DSSGQEKVLK KPDKVLPCPR CNSMDTKFCY YNNYNVNQPR HFCKNCQRYW  180
TAGGTMRNVP VGAGRRKNKH SASHYRHIMM SSDGLASGRV VAPDLTPHQA LPCGPSVSMR  240
PMKGNGSVLK FGPEVPLCES MASGLNLEEQ KKNPDFGSIA SGENKEDPSC ASSVTASNCV  300
ENGFPENAVP MEQNGTQGYC NGLTPMPHLQ CYPGAPWAYP WGPGWNNVAA MAASRCSSEL  360
VYGPENGTPS PIPWSPPSMM AAPAFCAPTI PFPFMPASFW GCMSSWPNGA WNVTWLGSNG  420
GISSSSSTSN SGCSGNGSPT LGKHSRDASL QGEEKMEKSL WVPKTLRIDD PDEAAKSSIW  480
ATLGIKPEEG GIFKPFQSKA ESKDQRSDAA QVLHANPAAF SRSRSFQEST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921318.10.0cyclic dof factor 2
TrEMBLA0A2H3XBG30.0A0A2H3XBG3_PHODC; cyclic dof factor 3-like
STRINGXP_008781227.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-49cycling DOF factor 2