PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010921141.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 390aa    MW: 42219.9 Da    PI: 6.381
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010921141.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.67.3e-10196243552
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                     kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  XP_010921141.1 196 KRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLF 243
                     9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-15192256IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.645194257IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.8E-10196250No hitNo description
SuperFamilySSF579598.84E-11196247No hitNo description
PfamPF001701.2E-8196242IPR004827Basic-leucine zipper domain
CDDcd147031.25E-24197246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MLPKCQDPRH PPNPNANHSP NLDLPSSFPP NAPPVAAGTM AMFQSAGTTP PPRGAHHRRA  60
RSEMAFRITD DIDLSSGDPL AGGGFDEIGS EDDLFSTFMD IEKIGCRPEG SGSGSEGGVF  120
GDPATESYKG GEDRKIDNAT GAAAAVRPKH RHSNSIDGSS MMSSGTTRGE GVFGDVEAKK  180
AMTAEQLAEL AAIDPKRAKR ILANRQSAAR SKERKARYIS ELERKVQTLQ TEATTLSAQL  240
TLFQRDTTGL SAENAELKLR LQAMEQQAQL RDALNEALRQ EVERLRIATG EISNPGETFN  300
MGLQHVPYNP SFYTLPQQQP VHHQGIQLQP QFHQSQPNVS NHQFAHSNAL PDMMQQDPLG  360
RLQGLDISKG SLIVKTESSS ISASESSSTF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921141.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-135RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0E0KDF41e-140A0A0E0KDF4_ORYPU; Uncharacterized protein
STRINGGSMUA_Achr6P32530_0011e-138(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-90bZIP family protein