PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010920933.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 297aa    MW: 31790.3 Da    PI: 7.4035
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010920933.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1282.7e-4041102263
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     +e++lkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  XP_010920933.1  41 PEQNLKCPRCDSTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNKRSSS 102
                     7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.0E-334399IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-234594IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5534599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEISNGDHQV MATLPLEEVL TGCPKTQQQQ QQQERKPRPQ PEQNLKCPRC DSTNTKFCYY  60
NNYSLSQPRY FCKGCRRYWT KGGSLRNVPV GGGCRKNKRS SSSTSKRAQD QALATNSNPP  120
LPTLLPPPLS YDPSDLSLAF ARLHKPPTGG QLGLDDHDSF LLGNPNSGHI PTGTPGFLDI  180
LRGGLFDTTT TTSGFHNLYY GFGGHGSVEQ VEDSVAGEEA VLPFDGGLTG ATTATTSSTP  240
TTSQGSCKAA DGGESKMFMG LQWQVGGGGN MAAMDPGRDY WNGGGSSWPG LINSSLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920933.10.0dof zinc finger protein DOF3.2 isoform X2
TrEMBLA0A2H3Y2Q31e-175A0A2H3Y2Q3_PHODC; dof zinc finger protein DOF3.2
STRINGXP_008792304.11e-176(Phoenix dactylifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-30TARGET OF MONOPTEROS 6