PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010920932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 315aa    MW: 34022.2 Da    PI: 8.5455
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010920932.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.93e-4059120263
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     +e++lkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  XP_010920932.1  59 PEQNLKCPRCDSTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNKRSSS 120
                     7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.2E-3361117IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-2363112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.55363117IPR003851Zinc finger, Dof-type
PROSITE patternPS01361065101IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MNPLQIRSNF PCFLCVQAKH IDRFVRKVMA TLPLEEVLTG CPKTQQQQQQ QERKPRPQPE  60
QNLKCPRCDS TNTKFCYYNN YSLSQPRYFC KGCRRYWTKG GSLRNVPVGG GCRKNKRSSS  120
STSKRAQDQA LATNSNPPLP TLLPPPLSYD PSDLSLAFAR LHKPPTGGQL GLDDHDSFLL  180
GNPNSGHIPT GTPGFLDILR GGLFDTTTTT SGFHNLYYGF GGHGSVEQVE DSVAGEEAVL  240
PFDGGLTGAT TATTSSTPTT SQGSCKAADG GESKMFMGLQ WQVGGGGNMA AMDPGRDYWN  300
GGGSSWPGLI NSSLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029120278.10.0dof zinc finger protein DOF3.2 isoform X1
TrEMBLA0A2H3Y2Q31e-167A0A2H3Y2Q3_PHODC; dof zinc finger protein DOF3.2
STRINGXP_008792304.11e-168(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.18e-30TARGET OF MONOPTEROS 6