PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010920614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 345aa    MW: 35952.2 Da    PI: 9.3921
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010920614.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.6e-3972132262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e alkcprCdstntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  XP_010920614.1  72 PEPALKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 132
                     67899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3656130IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3275130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.73976130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVFPTVPVYL DPRNWNQQQA HHQPQSSSGG VSGEPLQPPT GVVAARPEGP AAGLVRPGSM  60
VDRARLAKIA QPEPALKCPR CDSTNTKFCY FNNYSLSQPR HFCKTCRRYW TRGGALRNVP  120
VGGGCRRNKR TKPAGSSTSK SSTTTTTTDR QAGASSSTSS TATTVVGISG AIPSNLPMPP  180
QMPFMAATLH PLAEYNTPSI GLSFAGIQPV DAMDYQVGAS SSSAGGGVGL EQWRLPQIQQ  240
FPFFGGLEPP PPPPAPVSGL YPFDGEGSGV DGGAFAKATG SGLITQLASV KMEDNQHGLG  300
LPRQYPGVPR NDQYWGSSSG GGSSTGSGWA PDLSGFNSSS AGNLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125132RRNKRTKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920614.10.0dof zinc finger protein DOF5.1
TrEMBLA0A2H3X7L11e-147A0A2H3X7L1_PHODC; dof zinc finger protein DOF3.6-like isoform X1
STRINGXP_008779546.11e-148(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-50OBF-binding protein 3