PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010920204.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 236aa    MW: 25811.1 Da    PI: 10.2496
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010920204.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.41.2e-16166216454
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     ++r +r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +Lkk+leel+ 
  XP_010920204.1 166 DRRYKRMIKNRESAARSRARKQAYTNELELEVAHLLEENAKLKKQLEELRL 216
                     5799*****************************************999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-13163227IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.668165215IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.1E-15166215No hitNo description
SuperFamilySSF579593.81E-12167215No hitNo description
PfamPF001701.8E-14167215IPR004827Basic-leucine zipper domain
CDDcd147074.71E-26167221No hitNo description
PROSITE patternPS000360170185IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEEVWKDINL TSLHHERRFA PLPEPHHHHH HHHHRAMILQ DFLSGPCFTV SRANAAVEDI  60
PLPPPPPLLP PTALSLSSGR ELQYLGGGGG GGGGSALMNG HSRSSSNSNG SRVHGQANNN  120
DNNARSGPFM SPSFSDAVIG PSSPAGFFSF CSKKRVMPEG PGIGGDRRYK RMIKNRESAA  180
RSRARKQAYT NELELEVAHL LEENAKLKKQ LEELRLAMDA QLPNRIALKR SSSAPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920204.11e-173PREDICTED: protein FD
TrEMBLM0SXK13e-61M0SXK1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P11220_0019e-61(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.14e-27bZIP family protein