PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010920114.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 262aa    MW: 28602.5 Da    PI: 6.4979
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010920114.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1262e-0886129851
                     HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                     +r + NReA r++R++Kka ++ L+++  +L a N++L k+l++
  XP_010920114.1  86 KRPIGNREAVRKYREKKKAHTASLADELLQLRALNQQLMKRLQR 129
                     78889**********************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.0E-980146IPR004827Basic-leucine zipper domain
PfamPF077161.9E-1285136IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.0E-1285147No hitNo description
CDDcd146865.83E-1285138No hitNo description
SuperFamilySSF579591.44E-686130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MDDLDLDFQF PGPDVGDHMP RNCSINGFFD ESVKDMPRHS CTHTHTCNPP GPDLSHSHTC  60
FHAHTKILSA PAMETFESAE KSLPKKRPIG NREAVRKYRE KKKAHTASLA DELLQLRALN  120
QQLMKRLQRQ VALEAEVARL RCLLVDIRGR IEGEIGAFPY NRAAKMGGDV VSNATQGNFL  180
GAHIINSCDV LCDDQINCMQ LLMQGKDGDE DGDGALNGEK FDACEIGNIR CMGSSEVILA  240
CGGGNVMAAG CSSKAEKTKG LF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920114.10.0PREDICTED: uncharacterized protein LOC105044037
RefseqXP_010920115.10.0PREDICTED: uncharacterized protein LOC105044037
RefseqXP_010920117.10.0PREDICTED: uncharacterized protein LOC105044037
SwissprotQ8VY767e-70BZP19_ARATH; Basic leucine zipper 19
TrEMBLM0SAN51e-110M0SAN5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P00670_0011e-110(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.14e-71bZIP family protein