PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919729.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 293aa    MW: 32290.1 Da    PI: 7.0907
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919729.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-11175219549
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                     kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++
  XP_010919729.1 175 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRV 219
                     8999*********************************99998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-13171235IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.714173229IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-12175229No hitNo description
PfamPF001702.9E-10175224IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-12175229No hitNo description
CDDcd147031.33E-23176226No hitNo description
PROSITE patternPS000360178193IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MAQLPPKIPT TFPPTWPNFG HHRPPFSSIP TPAAPSPPAP SSQPSWVDEF LDFSSAKRGS  60
HRRSVSDSIA FLEAPLADDA AAAAEFDRLD EDQLIESMFS DDVPPPSSSS PRAAPPLTSS  120
NPSTPSDHNS INDDKPAASS DHQTTMSNDF AAEAQSACKA EPKPATEPEH IVDPKRVKRI  180
LANRQSAQRS RVRKLQYISE LERSVTTLQT EVSALSPRVA FLDHQRSILT LGNSHLKQRI  240
AALAQDKIFK DAHQEALKKE IERLRQVYHQ QNLKKMSAPT SDPAMRTEKE LVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919729.10.0PREDICTED: basic leucine zipper 61-like
SwissprotQ9M2K41e-104BZP61_ARATH; Basic leucine zipper 61
TrEMBLM0TAI81e-123M0TAI8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P26930_0011e-123(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-83bZIP family protein