PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 322aa    MW: 34017 Da    PI: 8.4823
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919290.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-3946105261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ke+al+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s
  XP_010919290.1  46 KEQALNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRS 105
                     7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3042104IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3348104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.19950104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MDAAQWHQEL GLVKPMEELV SSATTSTACS NTTRPQMMER RARPQKEQAL NCPRCNSTNT  60
KFCYYNNYSL TQPRYFCKTC RRYWTEGGSL RNVPVGGGSR KNKRSLLLST TSASASATSS  120
TVTATASAVS TSRKLPPELT ATPISLSTSS QNPKFHEGQD LNLAFPHHSL PEFNDFPHLE  180
SSTNNKTSSS GNSGNNPCTA VGALSAMELL RSGMGARGLG PFMPMPMPMP EYPAGFGVGL  240
QEFRPPTLGF PLDGVGGGGG GSGGGGGVLQ GVQESTGGRL LFPFENLKPV LSTTAAEFEQ  300
NGGQGGDQPG FWNGMMGGGG SW
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919290.30.0LOW QUALITY PROTEIN: dof zinc finger protein 2-like
SwissprotQ9SXG81e-72DOF1_ORYSJ; Dof zinc finger protein 1
TrEMBLA0A2H3Z1481e-161A0A2H3Z148_PHODC; dof zinc finger protein 2-like isoform X1
STRINGXP_008806927.11e-162(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-51Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]