PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 465aa    MW: 49492.9 Da    PI: 6.199
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919170.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.77.8e-11386444563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr +r   NR +A rs +RK ++i+eLe kv+ L++e ++L  +l  l+  +a l s++
  XP_010919170.1 386 KRVKRILANRQSAARSKERKMKYIAELEHKVQILQTEATTLSAQLTLLQGDSAGLSSQN 444
                     899*********************************************99999888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.8E-17382446IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.277384447IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.1E-11386443No hitNo description
PfamPF001702.5E-10386444IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-11386436No hitNo description
CDDcd147038.95E-26387434No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MEDAARNDLT RRFRGNPSVS TSNPQQNASD GPQIGGPYHH LGPPLGPEPC RRPGIPPASP  60
FSHFLTSAAR SPPSLAAGGP FNHPRSLSPP AFFSLDSVPP LSPPPCRDCT PTTSLSDSVS  120
ADVSMEDHDA SSRSPPLPPK AGGAAWAAPT GDGLLPPKAH RRSQSEIPFA FFQSSPSPAT  180
SPLPPPASAE APPPQMVKLE PNWDWCMNAE AAGDKKPEGD SGDDLFDAYL NLDSLDTLDS  240
SEDKREDLNS GASGSKTNGD SSENEAESSV NGSGVKFRPH HGPSVEKREG TKRSAVGDPG  300
PIGSGNRHCR SLSMDSFIGK SNFGEESPKL STSPGFLAAQ TLQANSKDGA SNVFSLEFGK  360
GEFSPAEMKK IMANERLVEM ALTDPKRVKR ILANRQSAAR SKERKMKYIA ELEHKVQILQ  420
TEATTLSAQL TLLQGDSAGL SSQNNELKFR LQAMEQQAQL RDAAN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919167.10.0PREDICTED: transcription factor RF2a-like isoform X1
RefseqXP_010919170.10.0PREDICTED: transcription factor RF2a-like isoform X3
TrEMBLA0A068TM071e-145A0A068TM07_COFCA; Uncharacterized protein
STRINGVIT_03s0038g00860.t011e-143(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.35e-71bZIP family protein