PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919084.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GRAS
Protein Properties Length: 629aa    MW: 66649.1 Da    PI: 7.9284
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919084.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS334.32.2e-1022496292374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++ L++ + a+ +g++++a+a L+ l+  a+ +gdp qRl+a+++ AL +r+  s ++  +  +  + +e  s e+l a+++++++sP++  + l
  XP_010919084.1 249 RQMLFDTVAAIVDGNQKAATANLEVLKRAANRHGDPEQRLTAMMVAALYSRIETSPPSSGALHH--PIAELCSPEHLEATQMLHDLSPCFGHALL 341
                     689999***********************************************95444443333..33334699********************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.....egppslRiTgvgspesg......skeeleetgerLakfAeelgvpfefnv 180
                     +aN aIlea+  ++r+Hi+Dfd++qG Q++aL+qaLa+       + pp+++iT+v++p+s        +++l+ +g+ Lak+Ae++gv ++f++
  XP_010919084.1 342 AANLAILEATRDASRIHILDFDVGQGRQYMALIQALAEHHrhrpsARPPNVKITAVADPTSPfnsfsnVSRRLRMVGDLLAKLAERFGVVLRFSI 436
                     *************************************655345566699*********9988899998899***********************9 PP

            GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                      v++r ++l+  +L ++pgE+laVnl++ l r+ desvs +++rde+L+ v+ l P+vvv+veqe++ n+++F++rf+ea+ +y al++slea++
  XP_010919084.1 437 -VCRRAAELDETTLGCEPGEVLAVNLAFVLSRVADESVSPANPRDEILRRVRALGPRVVVLVEQEMNGNTAPFAARFAEACGHYGALLESLEATV 530
                     .8********************************************************************************************* PP

            GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvs 369
                     +re+ +r+ vE   l+r++ n va ega+r+er+e ++kWr+r+++aGF+pvpl+  +a+ +k+  + ++ + g++v+ee g l++gW++r L++
  XP_010919084.1 531 GRENGKRARVEDC-LARKAANSVAGEGADRIERCEVFGKWRARMGMAGFRPVPLGPAVAEPVKSRFASTGsNPGFTVKEEAGGLCFGWSSRVLTV 624
                     ***********97.********************************************************99*********************** PP

            GRAS 370 vSaWr 374
                     +SaWr
  XP_010919084.1 625 TSAWR 629
                     ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.473222608IPR005202Transcription factor GRAS
PfamPF035147.7E-100249629IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MASGFPGRDL RGGLGFGAGS AIQVPPFANR SEPAGGGGGG AAAAAAGGLL KRSLNEMERQ  60
HQLQLQHALF LRSVKRRTHL ASPISPLSSV GLSSSSASSF SPDRSAFTTS SSSSLSTSSF  120
SSGLGYARRQ QPNAPDFSFS TAATVPAAAA AAPSCVTESE NKSTMRKRLL EELERRLLDD  180
EDEDEDEVSA SGCSAVTTSE WSEAMQRLLS PTPATVAAQH PLSPSPTTSS SSTTSSSASC  240
SPPSATPSRQ MLFDTVAAIV DGNQKAATAN LEVLKRAANR HGDPEQRLTA MMVAALYSRI  300
ETSPPSSGAL HHPIAELCSP EHLEATQMLH DLSPCFGHAL LAANLAILEA TRDASRIHIL  360
DFDVGQGRQY MALIQALAEH HRHRPSARPP NVKITAVADP TSPFNSFSNV SRRLRMVGDL  420
LAKLAERFGV VLRFSIVCRR AAELDETTLG CEPGEVLAVN LAFVLSRVAD ESVSPANPRD  480
EILRRVRALG PRVVVLVEQE MNGNTAPFAA RFAEACGHYG ALLESLEATV GRENGKRARV  540
EDCLARKAAN SVAGEGADRI ERCEVFGKWR ARMGMAGFRP VPLGPAVAEP VKSRFASTGS  600
NPGFTVKEEA GGLCFGWSSR VLTVTSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4626762922375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17478KRRTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919084.10.0PREDICTED: scarecrow-like protein 8
TrEMBLM0SSA20.0M0SSA2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P26400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-110SCARECROW-like 8