PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010918445.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 293aa    MW: 32151.7 Da    PI: 8.7774
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010918445.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.73.3e-3548104561
          zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      l cprC+s+ntkfCyynnys sqPr+fCk+Crr+Wt+GG+lrnvPvGggr++++++
  XP_010918445.1  48 PLVCPRCESSNTKFCYYNNYSKSQPRHFCKTCRRHWTEGGTLRNVPVGGGRKNKRQK 104
                     578**********************************************98776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2149102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.43849103IPR003851Zinc finger, Dof-type
PfamPF027015.3E-3149102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGLSSNQASA TGLDWSQDIL RNGGLEMPKL ANHARNQQQQ QQRQHWPPLV CPRCESSNTK  60
FCYYNNYSKS QPRHFCKTCR RHWTEGGTLR NVPVGGGRKN KRQKNTPTTS TSGEGSAADN  120
NDTKPGITNS GSVMPPQPQR HQKQSLLPFA RDHCSSIFPE VLRQVLLRPP SMPLQAEYSV  180
AGSFMGSPQA TDTPLPPPSQ FTTTMPLTIN SYSSIVHPFS TTSSSSSYFP YLSISEGPST  240
NINISMGSSW PVAPPPPPVS DPSSAYWSGW EDDISGYATT ELKLPHGDKT EQP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010918445.10.0dof zinc finger protein 4
TrEMBLA0A2H3XY401e-133A0A2H3XY40_PHODC; dof zinc finger protein 1-like
STRINGXP_008790500.11e-134(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.12e-28Dof family protein