PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010918248.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Nin-like
Protein Properties Length: 956aa    MW: 106433 Da    PI: 5.6459
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010918248.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.33.6e-29639689252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+i l++l+kyF++++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  XP_010918248.1 639 EKTIGLQELQKYFAGSLKDAAKSLGVCPTTLKRICRQHGISRWPSRKIKKV 689
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029628709IPR003035RWP-RK domain
PfamPF020423.4E-26642689IPR003035RWP-RK domain
SuperFamilySSF542773.08E-23854943No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-24857939No hitNo description
PROSITE profilePS5174524.646858941IPR000270PB1 domain
SMARTSM006662.0E-27858941IPR000270PB1 domain
CDDcd064075.19E-41859940No hitNo description
PfamPF005642.0E-17859940IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 956 aa     Download sequence    Send to blast
MEDNVLPTAS LPERALSDVV VELDLMDEFL SVPGFDCSDF LQPGTSTSTS PFSSSGFSPL  60
FEVSNGGCNP VLPEDNNQDD VERSVFSVDL PSDEIQIELL DRMQSPDPNA GEQPKFSAQL  120
NELRMNNPSS ELHSSWWIQP SAHMETMEER LIRAINYIKD SQRDGDVLVQ IWVPTRIGDR  180
HVLTTRGQPF TLDSTCQRLV NYRTVSTQYQ FSAEENSNVA VGLPGRVFLG RVPEWTPDVR  240
YFSHYEYPRV NDAQRYDVRG SLALPVFDRN SRSCLGVVEV VMTTQKINYS SDLENICNAL  300
QAVNLRSSEV PGVPHVKVCN ESYQVALPEI QRVLRAVCET HSLPLAQTWI SCIQQGKSGS  360
RHTDENYKDC VSTVDVACYV RDPTMLGFHQ ACSEHHLFKG QGVSGKAFTT NQPCFSSDIT  420
AFSKTEYPLS HHAKLFHLRA AVAIRLRSIH TGTADFVLEL FLPINCIEHE EQKLMLNSLS  480
ITIQQVCQSL RVVTSKELEH EAILQVAQLN SSNVLPDKFV SETSQRLDDD DNLLTESPMI  540
GVSGEVSSWS GSIRETQENG GKSVLPTSVP LDFNEQEIEG LSVWHTSEVV LPAGKIFSEF  600
KQHEEELTKD SIDHKTFFSG EPGFSNTEKA MEKRRTKTEK TIGLQELQKY FAGSLKDAAK  660
SLGVCPTTLK RICRQHGISR WPSRKIKKVG HSLRKLQVVI DSVHGPEGTF QFSSLYENFT  720
KATWSNESLP GSTSFSTLKQ KENPESSTAN QQQEAKLSSH TSGSNSLSSS SCSHSSSSSL  780
GCSSGTKQCS NAQLSIKQEI SVEENQSGML NKIQIPIELQ LSAKEGPISL ARSQSHELLS  840
EQPFSGTHAA LHWSRHDSLK VKAIYGEDKV IFKLQPTWGF QDLKQEIGKR LNIGNINLVA  900
LKYLDDDSEW VLLTCDADLQ ECIDVYKLSS ARTIRISVHH VPQEITKSSL GHSPDN
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010918248.10.0protein NLP1 isoform X1
RefseqXP_010918249.10.0protein NLP1 isoform X1
RefseqXP_010918250.10.0protein NLP1 isoform X1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A2H4A0L60.0A0A2H4A0L6_PHODC; protein NLP1-like
STRINGXP_008812750.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]