PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010917179.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GRF
Protein Properties Length: 349aa    MW: 39885.3 Da    PI: 7.5818
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010917179.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.5e-2483126144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRC +++++++k+CErH+hrg++rsrk++e
  XP_010917179.1  83 DPEPGRCRRTDGKKWRCAKEAYPDSKYCERHMHRGKNRSRKPVE 126
                     79***************************************998 PP

2QLQ59.41e-201247237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT++Q+q+L++Q+l++Ky+a++ P+P++L++++++
  XP_010917179.1 12 PFTPSQWQELEHQALIFKYMASGIPIPSDLILPLRR 47
                    8********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-101147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.1821247IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.3E-151245IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.92183127IPR014977WRC domain
PfamPF088792.7E-2084126IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MMSGRSSSCR HPFTPSQWQE LEHQALIFKY MASGIPIPSD LILPLRRSYL LDSTITSPTL  60
AFPPQPSMNW GWNQVGFGRK ADDPEPGRCR RTDGKKWRCA KEAYPDSKYC ERHMHRGKNR  120
SRKPVEMSLA TTLPSSTTST TSSTSHNPSP YPPLPLSIST PDSYHLLYPY HSSSRPPGVV  180
LNTPHFNLDT PTYTQPDKDY RYCHGMKDVD EYSFFSEASG SERESSWQFR PLGMSLLGES  240
KQGSSALQQN AYSQCERDAE EKQQQHCFVL GADFKLERPG KVDREQEGQR PLRHFFDEWP  300
QKSKDSWVDL EQENSNQASA AYSKTQLSIS IPMSHHDFPV TSCRYRNDD
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917179.10.0growth-regulating factor 1
SwissprotQ6AWY81e-104GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A2H3XPD20.0A0A2H3XPD2_PHODC; growth-regulating factor 1-like
STRINGXP_010273920.11e-109(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-50growth-regulating factor 5