PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010917116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 302aa    MW: 33226.3 Da    PI: 6.7221
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010917116.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.58.1e-15235278548
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                     +r++r++kNRe+A rsR+RK+a+i +Lee+v +L++ Nk+Lkk+
  XP_010917116.1 235 RRQKRMIKNRESAARSRARKQAYINQLEEEVRQLTNTNKRLKKQ 278
                     79***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.1E-13224278No hitNo description
SMARTSM003381.1E-10231298IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76233278IPR004827Basic-leucine zipper domain
CDDcd147076.57E-23235280No hitNo description
PfamPF001702.7E-12235278IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.74E-10235278No hitNo description
PROSITE patternPS000360238253IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MVSPNRGQGP QCPPPFVRQG SVPNLTLDEV PSHLSELGKP LNAMNLNELL NSVMAVEQHI  60
HAPSSSLSSA STAQPLSENY NMNCPLIHKT LDEIWQEVIQ LEGQGNTESP ATFGETTLKD  120
ILVRAGTINM GSSGCGGVEG DSQALFSVDP EQQEDWLQYQ LAAAQQQQQQ HQHMALLGSG  180
LSVLGNAISN AGFSEIQQMG LPMVSMAMTR TTSSDSHTPT ETHRPDEIVD KNIERRQKRM  240
IKNRESAARS RARKQAYINQ LEEEVRQLTN TNKRLKKQKI RKSGIDNSQQ AATMFSVSAI  300
QK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917116.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM0S5Z35e-66M0S5Z3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P07520_0011e-65(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2547835
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-32ABA-responsive element binding protein 3