PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010917059.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 457aa    MW: 49847.4 Da    PI: 6.8677
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010917059.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-39110169261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k+l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  XP_010917059.1 110 PDKILPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSS 169
                     7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29108167IPR003851Zinc finger, Dof-type
PfamPF027019.8E-32112168IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.779114168IPR003851Zinc finger, Dof-type
PROSITE patternPS013610116152IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MAEIRDLAIK LFGKTIPLQS TGESPPVSGG SEESSGKEEK DHKEETTPET KDQDIESPDS  60
EEKSDSPTSI AGETDKLSFG NQEDTNIKDS KSKEQSNGTS NSQEKAPKKP DKILPCPRCN  120
SLDTKFCYFN NYNVNQPRHF CKNCQRYWTA GGTMRNVPVG AGRRKNKSSI SHYRHITMDT  180
LQTVRSDAME AIHHPPINSN GTVLSFGSDT PLCESMASVL NLVEKNMKNC TRNGYHQMEE  240
QMVPLSCRAE NGDEHSSGSS AMASNSKHEA AKTGLQGVPA PIPYFNGTPW PYQWNPATPF  300
CTSSFAIPVY PATAYWGCAV PGSWGIPWLS PLASSPPNSG SPGSGPNSPT LGKHSRDGHI  360
LKGSNVEKED GFKQTNQETC IWVPKTLRID DADEAAKSSI WAMIGIKNDK ADAVSGRGIF  420
KAFQPKIDIK NHTSETSQLL HANPAALSRS LHFQESS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917059.10.0cyclic dof factor 2
TrEMBLA0A2H3YYY80.0A0A2H3YYY8_PHODC; cyclic dof factor 2
STRINGXP_008806017.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.25e-92cycling DOF factor 2