PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010916941.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 373aa    MW: 42415.3 Da    PI: 6.8536
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010916941.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.5e-1277119446
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                     +k+ rr+++NReAAr+sR+RKk +i++Lee   +L++  ++L 
  XP_010916941.1  77 DKVLRRLAQNREAARKSRLRKKVYIQQLEESRMKLTQLEQELE 119
                     7999**************************8888887776443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.9E-867121No hitNo description
SMARTSM003385.3E-774135IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.86476120IPR004827Basic-leucine zipper domain
PfamPF001709.3E-977119IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.38E-778122No hitNo description
PROSITE patternPS0003608196IPR004827Basic-leucine zipper domain
PfamPF141441.5E-30174247IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MSFQSTRYSS CSTMGIYEQN HQVSMWDDSF RADSSQYTCS STVLEADVKI DSGFENITHE  60
TLGSSKKSNQ EANKPGDKVL RRLAQNREAA RKSRLRKKVY IQQLEESRMK LTQLEQELEQ  120
VRQQELESIM SGRHTILLLS SCAPYIDPCL GLVGIAAFEM EYGHWVEEQN RHTCGLRAAL  180
HAHVSDLELR ILVESGMRHY DELFRIKALA AKSDVFYLMS GMWKTSAERF FLWIGGFRPS  240
EILKVVSPQL DPLTEQQLVA VYNLQQSSQQ AEDALSQGLD KLRQTLAETI ISDPLDTPNM  300
ANYMGLMTNA MGKLEALISF VNQADHLRHQ TLQLVYQILT TRQAARGLLA IGDYFQRLRA  360
LSSLWAARPR ELA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010916941.10.0PREDICTED: transcription factor TGA4
SwissprotQ391621e-146TGA4_ARATH; Transcription factor TGA4
TrEMBLM0SZ420.0M0SZ42_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P16630_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35713877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-138TGACG motif-binding factor 4