PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010916876.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family CAMTA
Protein Properties Length: 1048aa    MW: 118012 Da    PI: 5.8957
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010916876.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1181.31.1e-56201362118
            CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                     l+ ++rwl++ ei++iL n++k++++ e++++p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+v+vl+cyYah+een++fqr
  XP_010916876.1  20 LEAQHRWLRPAEICEILRNYRKFHIAPESPNKPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQR 114
                     5679******************************************************************************************* PP

            CG-1  97 rcywlLeeelekivlvhylevk 118
                     r+yw+Lee++ +ivlvhylevk
  XP_010916876.1 115 RSYWMLEEDYMHIVLVHYLEVK 136
                     *******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143784.41915141IPR005559CG-1 DNA-binding domain
SMARTSM010761.2E-7918136IPR005559CG-1 DNA-binding domain
PfamPF038595.0E-5021135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.101.8E-5461550IPR013783Immunoglobulin-like fold
PfamPF018339.7E-7463541IPR002909IPT domain
SuperFamilySSF812961.1E-16463549IPR014756Immunoglobulin E-set
PROSITE profilePS5029719.014648759IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.5E-19654761IPR020683Ankyrin repeat-containing domain
CDDcd002048.66E-15654757No hitNo description
SuperFamilySSF484031.41E-17654759IPR020683Ankyrin repeat-containing domain
PfamPF127969.2E-8670760IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500889.137698730IPR002110Ankyrin repeat
SMARTSM002480.019698727IPR002110Ankyrin repeat
SMARTSM00248770737766IPR002110Ankyrin repeat
SuperFamilySSF525401.46E-8871926IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000153.8873895IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.297875903IPR000048IQ motif, EF-hand binding site
PfamPF006120.002875894IPR000048IQ motif, EF-hand binding site
SMARTSM000159.7E-4896918IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.505897921IPR000048IQ motif, EF-hand binding site
PfamPF006127.4E-5899918IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1048 aa     Download sequence    Send to blast
MADARRYGLT PQLDIEQILL EAQHRWLRPA EICEILRNYR KFHIAPESPN KPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKAGSVDVLH CYYAHGEENE NFQRRSYWML  120
EEDYMHIVLV HYLEVKGNKP SFSRTRDVDE IAQVANMESP VCSNSFTNHS QLPSQTTSAE  180
SPNSPHTSEY EDAESADNYQ ASSRYNSFLE MQQYGDGPVM DAHLLNPHVP VDSINNQCDI  240
QGAKATEPKS DFYSVVQENI TRVFDETGLG FTFSGSRTQF DLTSWDEVLE HYTTGFQTPS  300
FYPAVASTPS STVEDNLRLE TSTLGELHTD DLGFKQVDVA SAQDKSLWQL SSADIDPLVS  360
SNVGLQNGAS IEENVNAPSL ITQASLDFSN IEGEGLKKYD SFSRWMNNEL GEVDDSHMKS  420
SSGVYWNTVE SESVVEDSSM SNREHLDAYI VSPSLSQDQL FSIIDFTPNW AYSGMETKVL  480
ITGTFLKNKA DVEKCQWSCM FGEIEVPAEI LRDGTLRCHA PSHKSGRVHF YVTCSNRLAC  540
SEVREFEFRE NDVQYMEASD SYGSNTNEMR LHIRLEKLLT LGPVDHLKAV PDSTKENLHL  600
RNKISSLMME ADDEWSNLLK LTHEGFSPDS ARDRLLEKLM KEKLHSWLLH KVAEDGKGPN  660
VLDKEGQGVL HLAAALGYDW AIKPTITAGV SINFRDVRGW TALHWAANCG RERTVVALIA  720
SGAAPGALTD PTPEFPTGRT PADLASTNGH KGIAGFLAES SLTNHLSALT LKESKGIDVT  780
EISGITDVED VAEKSAIQVA EGDVQAGLSL KDSLSAVRNA SLAAARIYQV FRVHSFHRKK  840
VTEYGNDKCG ISDERALSLI SLKTAKPGQH DMPPHAAAIR IQNKFRGWKG RKEFLIIRQR  900
IVKIQAHVRG YQVRKHYKKI IWSVLIVEKA ILRWRRKGSG LRGFRSEGLL EGPAMQNQGT  960
KEDDYDFLQE GRKQTEARLQ KALARVRSMV QYPEARDQYR RLLNVVTELQ ESKAMQDRIT  1020
NESEEAADGE FMIELEELWQ DDTPMPTA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010916876.10.0PREDICTED: calmodulin-binding transcription activator 3-like
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLM0T5T80.0M0T5T8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P10390_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60838140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1