PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010915576.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 296aa    MW: 32329 Da    PI: 6.9725
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010915576.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.93.3e-11163207549
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                     kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++
  XP_010915576.1 163 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPQV 207
                     8999*********************************99987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-14159223IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.082161217IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.27E-12163217No hitNo description
PfamPF001701.0E-9163208IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-14163217No hitNo description
CDDcd147038.84E-24164214No hitNo description
PROSITE patternPS000360166181IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAQLPPKIPN LSTEWPNFGY QKSPSMGTFF PAAAPSPAAQ PSWVDEFLDF SAAKRGAHRR  60
SVSDSVTFLE APADSDSMVH EFDRLDDGQL LSMFADDALH LSAAAAAPVS SSNTSTPSDR  120
NSNSDEKTGE LQQRNEAEEA QSTCKVEPQA TPAATPQPAI DPKRVKRILA NRQSAQRSRV  180
RKLQYISELE RSVTTLQTEV SALSPQVAFL DRQRSLLTVG NSHLKQRIAA LVQDKIFKDA  240
HQEALKKELE RLRQVHHQQS LDKMGAPTSD PAVPADNKLL RSDGATGGAH TRDTSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915576.10.0PREDICTED: basic leucine zipper 61
SwissprotQ9M2K41e-101BZP61_ARATH; Basic leucine zipper 61
TrEMBLC0HG101e-114C0HG10_MAIZE; BZIP transcription factor
STRINGAC233853.1_FGP0021e-113(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-81bZIP family protein