PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010915148.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Whirly
Protein Properties Length: 235aa    MW: 25810.5 Da    PI: 9.2419
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010915148.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly120.11.5e-3710919454139
          Whirly  54 sfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                     +f+ls+ e+++l+ l+ k+sceffhdp+++ s+eGk+rk++k ePlpdGsG+f+nlsv+n l++++es+++P++kaefa+l+s+++
  XP_010915148.1 109 VFSLSVPEIGTLLALGGKDSCEFFHDPFKGRSEEGKIRKVFKAEPLPDGSGHFFNLSVQNRLLNVDESIYIPITKAEFAILNSAFN 194
                     7*********************************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.109.5E-878107IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544478.63E-4280195IPR009044ssDNA-binding transcriptional regulator
Gene3DG3DSA:2.30.31.109.5E-32109194IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.3E-31109191IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MPLRGSSLVS LQNSPSPHPL LPSNSFKNVL SPGTLAPNRK KLSVSCRRSD YFDQQRFASP  60
TPRDSSFASQ PPGGPAVQSS RVFVGYSIYK GKAALTVEPK APEFTPLDVF SLSVPEIGTL  120
LALGGKDSCE FFHDPFKGRS EEGKIRKVFK AEPLPDGSGH FFNLSVQNRL LNVDESIYIP  180
ITKAEFAILN SAFNRMESDV FAVYLTIPSG LACFCKCHQT RGLHSFKQYD CAIRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A4e-594719412181p24: plant transcriptional regulator PBF-2
1l3a_B4e-594719412181p24: plant transcriptional regulator PBF-2
1l3a_C4e-594719412181p24: plant transcriptional regulator PBF-2
1l3a_D4e-594719412181p24: plant transcriptional regulator PBF-2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915145.11e-131single-stranded DNA-binding protein WHY1, chloroplastic isoform X1
RefseqXP_010915146.11e-131single-stranded DNA-binding protein WHY1, chloroplastic isoform X1
SwissprotQ9LL853e-62WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A3Q0IL681e-112A0A3Q0IL68_PHODC; single-stranded DNA-binding protein WHY1, chloroplastic-like
STRINGXP_008809721.11e-113(Phoenix dactylifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-64ssDNA-binding transcriptional regulator