PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010915144.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Whirly
Protein Properties Length: 265aa    MW: 29234.4 Da    PI: 9.7235
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010915144.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly207.21.8e-64862241139
          Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 
                     s+yk+kaal+v++++p+f+ ldsg++kl+++G++ll++a+a+a r+ydW++kq+f+ls+ e+++l+ l+ k+sceffhdp+++ s+eGk+rk++k
  XP_010915144.1  86 SIYKGKAALTVEPKAPEFTPLDSGAFKLSKEGFILLQFAPAAAARQYDWNRKQVFSLSVPEIGTLLALGGKDSCEFFHDPFKGRSEEGKIRKVFK 180
                     7********************************************************************************************** PP

          Whirly  96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                      ePlpdGsG+f+nlsv+n l++++es+++P++kaefa+l+s+++
  XP_010915144.1 181 AEPLPDGSGHFFNLSVQNRLLNVDESIYIPITKAEFAILNSAFN 224
                     ****************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.104.8E-6577224IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544476.04E-6079225IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.3E-5887221IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MPLRGSSLVS LQNSPSPHPL LPSNSFKNVL SPGTLAPNRK KLSVSCRRSD YFDQQRFASP  60
TPRDSSFASQ PPGGPVQSSR VFVGYSIYKG KAALTVEPKA PEFTPLDSGA FKLSKEGFIL  120
LQFAPAAAAR QYDWNRKQVF SLSVPEIGTL LALGGKDSCE FFHDPFKGRS EEGKIRKVFK  180
AEPLPDGSGH FFNLSVQNRL LNVDESIYIP ITKAEFAILN SAFNRMESDV FAVYLTIPSG  240
LACFCKCHQT RGLHSFKQYD CAIRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A3e-864722412181p24: plant transcriptional regulator PBF-2
1l3a_B3e-864722412181p24: plant transcriptional regulator PBF-2
1l3a_C3e-864722412181p24: plant transcriptional regulator PBF-2
1l3a_D3e-864722412181p24: plant transcriptional regulator PBF-2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}.
UniProtSingle-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In the nucleus, is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:19669906}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915147.11e-161single-stranded DNA-binding protein WHY1, chloroplastic isoform X2
SwissprotQ66GR68e-90WHY3_ARATH; Single-stranded DNA-binding protein WHY3, chloroplastic
SwissprotQ9LL851e-89WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A3Q0IL681e-142A0A3Q0IL68_PHODC; single-stranded DNA-binding protein WHY1, chloroplastic-like
STRINGXP_008809721.11e-142(Phoenix dactylifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.21e-91ssDNA-binding transcriptional regulator
Publications ? help Back to Top
  1. Lepage É,Zampini É,Brisson N
    Plastid genome instability leads to reactive oxygen species production and plastid-to-nucleus retrograde signaling in Arabidopsis.
    Plant Physiol., 2013. 163(2): p. 867-81
    [PMID:23969600]
  2. Zampini É,Lepage É,Tremblay-Belzile S,Truche S,Brisson N
    Organelle DNA rearrangement mapping reveals U-turn-like inversions as a major source of genomic instability in Arabidopsis and humans.
    Genome Res., 2015. 25(5): p. 645-54
    [PMID:25800675]
  3. Karpinska B,Alomrani SO,Foyer CH
    Inhibitor-induced oxidation of the nucleus and cytosol in Arabidopsis thaliana: implications for organelle to nucleus retrograde signalling.
    Philos. Trans. R. Soc. Lond., B, Biol. Sci., 2018.
    [PMID:28808105]