PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010914965.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family G2-like
Protein Properties Length: 463aa    MW: 50284.3 Da    PI: 6.277
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010914965.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31241296156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_010914965.1 241 KARRCWSPDLHRRFVNALQILGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 296
                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.19E-16238299IPR009057Homeodomain-like
PROSITE profilePS5129413.13238298IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-28239299IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-26241296IPR006447Myb domain, plants
PfamPF002492.3E-6243294IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MDSPSDLSLD FKPNSYPMIQ KSLGDQTDQT QKIQEFLAHL EEERLKIEAF KRELPLCMQL  60
LNNAVETYRQ QLETYQTNQA PRPVLEEFIP LKHTSVDGSE KAPNAPSEKA SWMVSAQLWS  120
PANVATRNQQ PLSAAPLKET EHAFDVSPKL ALDTKQRNGG AFLPFSKEKN KGMGSASREL  180
PELALASSEK AVEEKKSCVE MDGGSIGMRR DNGGKGGGAE QGKSGSNPAT EGQPAPQTHR  240
KARRCWSPDL HRRFVNALQI LGGSQVATPK QIRELMKVDG LTNDEVKSHL QKYRLHTRRP  300
IPAPQASVAA APQLVVLGGI WVPPEYATSA AAAGQAIYGA HAAPAHYCPT PVPQELYAAP  360
PLPHHHHHHL HPPLHRSTAA ATAASAYKNR LGSPESEVRS GGERSESIAE EEEGEEREEE  420
EEEEDDGEAA AATEGKVEKK ALVPLAVKTE EGGGRGGEVA LKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-14241294255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-14241294255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-14241294154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14241294154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14241294154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14241294154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-14241294255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-14241294255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-14241294255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-14241294255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-14241294255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-14241294255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010914965.10.0transcription factor NIGTH1
SwissprotQ9ZQ851e-107EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A2H3Y1Q20.0A0A2H3Y1Q2_PHODC; transcription factor NIGTH1
STRINGXP_008792133.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-95G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]