PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010914518.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family M-type_MADS
Protein Properties Length: 360aa    MW: 40375.2 Da    PI: 5.9248
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010914518.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.82.5e-221053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    + en+s rqvt+skRr+gilKKA+ELS+LCd++  +++fs+tgk
  XP_010914518.1 10 KLENSSGRQVTYSKRRAGILKKAKELSILCDIDLVLLMFSPTGK 53
                    679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.698153IPR002100Transcription factor, MADS-box
SMARTSM004326.5E-30160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRQVT YSKRRAGILK KAKELSILCD IDLVLLMFSP TGKPTLCVGD  60
RSTIEEVVAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFMGSS SQTVEHLTNH  120
LSSLQAQLSD VQKRLSYWTD PDKINNVDHI GAMEQSLQES LSRIQVHKEN LGKQLMSLDC  180
SGQFQDDIHL PLGLGSEHGP SPVAWLHNND GQQMMLPEDP HLLPQRSAGN LLPHRDIGCS  240
TDTSIQSYSG YFNTGKQAEA NDQLQEDSLH EFSQNACLRL QLGGQYPYQS YCQNLIGENA  300
FKPDTENSLP ESTIDYQVDH FEPPRPGYDA SFQNWASTSG TCDVAIYDDQ SYSRTQNGFP
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029118788.10.0agamous-like MADS-box protein AGL65 isoform X4
SwissprotQ7X9I03e-93AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A2H3YDL40.0A0A2H3YDL4_PHODC; agamous-like MADS-box protein AGL65 isoform X1
STRINGXP_008797164.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-95AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]