PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010912876.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MIKC_MADS
Protein Properties Length: 200aa    MW: 22631.3 Da    PI: 7.5581
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010912876.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF793.2e-251058250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    rien  +rqvtf+kRr+g+lKKA ELSvLC+a++ +iifs++gklye +
  XP_010912876.1 10 RIENPVQRQVTFCKRRAGLLKKARELSVLCGADIGIIIFSTHGKLYELA 58
                    8*********************************************965 PP

2K-box614.7e-218317310100
           K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     e ++ + ++qe++ Lk+ei+ Lq+ +R + Ge+ + ++l eLq Le++Le  + +iRs+K+++++++i+ l++ke  l+ +n+ L++k++e
  XP_010912876.1  83 EVNQPQVSEQEISMLKQEINLLQKGIRYMHGEGEGHMTLGELQALERHLEIWMCHIRSTKMQIMFQEIQLLKNKEGILKAANEILQEKIAE 173
                     55677999********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.184161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-27174IPR002100Transcription factor, MADS-box
CDDcd002653.32E-37271No hitNo description
PRINTSPR004041.1E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.8E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-253859IPR002100Transcription factor, MADS-box
PfamPF014864.6E-2484171IPR002487Transcription factor, K-box
PROSITE profilePS5129712.84187177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MARGKVQMRR IENPVQRQVT FCKRRAGLLK KARELSVLCG ADIGIIIFST HGKLYELATN  60
GDMQSLIERY KSIGAEAQIE GGEVNQPQVS EQEISMLKQE INLLQKGIRY MHGEGEGHMT  120
LGELQALERH LEIWMCHIRS TKMQIMFQEI QLLKNKEGIL KAANEILQEK IAEQNGLFDI  180
GAVTAGIPYP LTIQDNIFQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-15190178MEF2C
5f28_B3e-15190178MEF2C
5f28_C3e-15190178MEF2C
5f28_D3e-15190178MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912876.11e-145MADS-box transcription factor 26-like
SwissprotA2YQK94e-85MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G84e-85MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLM0RTL52e-97M0RTL5_MUSAM; Uncharacterized protein
STRINGXP_008782100.11e-130(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-65AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]