PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010912776.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 387aa    MW: 42576.3 Da    PI: 6.2367
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010912776.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.5e-10201259563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+     l++e+
  XP_010912776.1 201 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSTQLTMLQRDTNGLTAEN 259
                     9**********************************************999888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-16197261IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.955199262IPR004827Basic-leucine zipper domain
PfamPF001706.5E-9201256IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.56E-11201252No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-10201255No hitNo description
CDDcd147031.38E-22202251No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MEKEKSPVHG GGSAGGGLPP PLPRTPDSGH FGQRVVPDIG QFSHDISRMP EHPPRNVGHR  60
RAQSEILSLP DDISFDNDLG VVGAGEGPSL SDETEEDLLS MYLDMDKLTS SSATSELDLR  120
GSEKSATAAV PAPSFPLQTE NSASASHEKP RVRHQHSQSM DGSTSIEPEI LASGSEGPSL  180
AETKKVMSAA ELADLALVDP KRAKRIWANR QSAARSKERK MRYIAELERK VQTLQTEATT  240
LSTQLTMLQR DTNGLTAENN ELKLRLQTME QQVHLQDALN DALREEVQRL KIATGQAIPN  300
GGQIMNFGPS FGTTQQYYHQ SHAMQSLLAA RQLQQLQIHS QHQQQMHPQQ HQPQVQQQQQ  360
QSPAELKMKG VMTSQRESTS DNITSQE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912776.10.0PREDICTED: probable transcription factor PosF21 isoform X2
SwissprotQ040881e-135POF21_ARATH; Probable transcription factor PosF21
TrEMBLM5XCD01e-161M5XCD0_PRUPE; Uncharacterized protein
STRINGGSMUA_Achr11P14990_0011e-154(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-134bZIP family protein