PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010912636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 364aa    MW: 41169.7 Da    PI: 8.8443
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010912636.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.75e-082332771761
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                     A+rsR RK+++i+eLe+ v++L+ae ++   ele l ++   l  
  XP_010912636.1 233 AQRSRVRKLQYIAELERNVQALQAEGMEVSAELEFLDQQNLILNL 277
                     89********************************99998766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-4222281IPR004827Basic-leucine zipper domain
CDDcd147031.79E-14223272No hitNo description
SuperFamilySSF579592.01E-5233275No hitNo description
Gene3DG3DSA:1.20.5.1706.7E-8233275No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MANTKGAANF RNSASSGKQS FLPPKSPFPT MPVSYSDYGT IGSKGIPKPR EGHRHHQRTS  60
SESFLEEQPS WLDELLNEPE TPVKRGAHRR STSDSFAYLD GANIYANMEN LSQEEGRQRG  120
ITSQTLWGAQ DFDRQHAPYY AEANSFGKPQ NRGWETMNMV NYPSGALLAK DKTVHPGSTC  180
VPRDADAATS NVTEKKEQEQ SPQDSKGISE RKKEGSHAKQ FDVDPKRVKQ QFAQRSRVRK  240
LQYIAELERN VQALQAEGME VSAELEFLDQ QNLILNLENK ALKQRLDSLA QEHLIKRFQQ  300
EMLEREIARL RSLYQQQQQQ LQQPPAPTHG RSSSRDLESR FANLSLKHED PNSGRDPVTG  360
PLNI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912636.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLM0TUP21e-148M0TUP2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P29390_0011e-147(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.22e-90bZIP family protein